PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G07270.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 352aa    MW: 39880.3 Da    PI: 6.8497
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G07270.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.66.9e-28958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtfskRrng++KKA+ELSvLCd+++a+++fs++g+l  +s
  LPERR06G07270.2  9 KRIENSTNRQVTFSKRRNGLIKKAYELSVLCDIDIALLMFSPSGRLSHFS 58
                     79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.758161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-38160IPR002100Transcription factor, MADS-box
CDDcd002653.33E-38278No hitNo description
SuperFamilySSF554558.11E-30286IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRVKLQIKR IENSTNRQVT FSKRRNGLIK KAYELSVLCD IDIALLMFSP SGRLSHFSGR  60
RRIEDVITRY INLPESDRGG IIHNREYLVK MLTQLKCESD ATEELTNTSS KAPVNSNIEE  120
LQQEIRTYQQ QVQLAEEQLR MFEPDSASLA SMENVEGCEK FISDMLRRVE ERKRYLLCSH  180
MGSFDVTAST SAMQHLYMPP QQQHGDIAGA VFGSDEVASW VSDGMAPGTS SVASMFAGPS  240
DSIMPFRDQA MYDSMHREAD VEAVGPGVQM CHVDQQGQGD DWNQYTPAEL FSAFIPSTPF  300
PLDEDVISIA PVLTSPPPMM TTIHHRRRWV RQRRRAARKH RRSTTTIMVC IT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-16270168Myocyte-specific enhancer factor 2A
3mu6_B2e-16270168Myocyte-specific enhancer factor 2A
3mu6_C2e-16270168Myocyte-specific enhancer factor 2A
3mu6_D2e-16270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693806.10.0PREDICTED: agamous-like MADS-box protein AGL66 isoform X3
SwissprotQ1PFC22e-69AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLA0A0D9WNF70.0A0A0D9WNF7_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g11970.11e-176(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.11e-70AGAMOUS-like 66